PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0006s0620.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 506aa    MW: 56136 Da    PI: 6.343
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0006s0620.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS346.93.3e-1061455001374
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                             l++lLlecA a+s ++l +a+++L +l  +asp+g +  +R+ ayf +A+a+r+++s+ ++++ l   ++       +  a+++f++
  SapurV1A.0006s0620.1.p 145 LITLLLECAVAISVDNLGEAHRILLELTMMASPYGpSCAERVMAYFSKAMASRVLNSWLGICSPLINHKS-------VHGAFQVFNN 224
                             5789*******************************9999**********************976644443.......568999**** PP

                    GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelg 173
                             +sP++kf+h+t NqaIlea+++ + vHi+D+di+qGlQWpaL++ L++R egpp++R+Tgvgs    s e l etg++L+kfA++lg
  SapurV1A.0006s0620.1.p 225 ASPFIKFAHFTSNQAILEAFQRRDSVHILDLDIMQGLQWPALFHILSTRMEGPPHVRMTGVGS----SMEVLVETGKQLSKFASRLG 307
                             ***************************************************************....******************** PP

                    GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                             +pfef++ vak++ +++ ++  +++gE+laV++    h+l+d +++  +    +L+l+  l P+v++++eq+++ n++sFl+rf+ +
  SapurV1A.0006s0620.1.p 308 LPFEFHP-VAKKFGEIDASMVPLRRGETLAVHWLQ--HSLYDATGPDWK----TLRLLEALAPRVITLAEQDIS-NGGSFLDRFVGS 386
                             *******.7*************************9..999999999888....*******************97.6999******** PP

                    GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.s 346
                             l+yysalfdsl a lp ++  r+ +E+ ll rei n++a  g +r  +  ++++Wr+ l +  Fk+v++s + ++qa+l+l++++  
  SapurV1A.0006s0620.1.p 387 LHYYSALFDSLGACLPCDDPGRHRIEHCLLYREINNILAIGGPARSGED-KFRHWRSELAKISFKQVAMSGNSMAQAQLILNMFPpA 472
                             ********************************************77665.5************************************ PP

                    GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                             +gy++ + +g l lgWkd +L++vSaW+
  SapurV1A.0006s0620.1.p 473 HGYSLVQGDGILSLGWKDTRLFTVSAWT 500
                             ***************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.488119479IPR005202Transcription factor GRAS
PfamPF035141.1E-103145500IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MKAAYEMVHG PHEPWDYASV GFPAPISNPF PKQVIENRCL SLERNDDQLS EWVGHVTEQL  60
IDDLPDKETH ATDTRMVDGG NDIVPSSLLG DHFTPNKSMR RSYFDGNGEE LRWNYELGAV  120
QTNILEKEGS AGSSMSRIDE NGLSLITLLL ECAVAISVDN LGEAHRILLE LTMMASPYGP  180
SCAERVMAYF SKAMASRVLN SWLGICSPLI NHKSVHGAFQ VFNNASPFIK FAHFTSNQAI  240
LEAFQRRDSV HILDLDIMQG LQWPALFHIL STRMEGPPHV RMTGVGSSME VLVETGKQLS  300
KFASRLGLPF EFHPVAKKFG EIDASMVPLR RGETLAVHWL QHSLYDATGP DWKTLRLLEA  360
LAPRVITLAE QDISNGGSFL DRFVGSLHYY SALFDSLGAC LPCDDPGRHR IEHCLLYREI  420
NNILAIGGPA RSGEDKFRHW RSELAKISFK QVAMSGNSMA QAQLILNMFP PAHGYSLVQG  480
DGILSLGWKD TRLFTVSAWT SPASR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-501454994374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302035.20.0hypothetical protein POPTR_0002s03740g
RefseqXP_011028840.10.0PREDICTED: protein SCARECROW-like
SwissprotQ9M3841e-145SCR_ARATH; Protein SCARECROW
TrEMBLB9GRN90.0B9GRN9_POPTR; Uncharacterized protein
STRINGPOPTR_0002s03740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF117873138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-146GRAS family protein